PDB entry 1g2i

View 1g2i on RCSB PDB site
Description: crystal structure of a novel intracellular protease from pyrococcus horikoshii at 2 a resolution
Deposited on 2000-10-19, released 2000-11-08
The last revision prior to the SCOP 1.59 freeze date was dated 2000-12-27, with a file datestamp of 2000-12-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1g2ia_
  • Chain 'B':
    Domains in SCOP 1.59: d1g2ib_
  • Chain 'C':
    Domains in SCOP 1.59: d1g2ic_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g2iA (A:)
    mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
    efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g2iB (B:)
    mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
    efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g2iC (C:)
    mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
    efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk