PDB entry 1g2h

View 1g2h on RCSB PDB site
Description: solution structure of the DNA-binding domain of the tyrr protein of haemophilus influenzae
Class: transcription
Keywords: TyrR; protein structure; NMR; DNA-binding domain; helix-turn-helix motif, TRANSCRIPTION
Deposited on 2000-10-19, released 2001-03-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulatory protein tyrr homolog
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1g2ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g2hA (A:)
    savisldefenktldeiigfyeaqvlklfyaeypstrklaqrlgvshtaianklkqygig
    k