PDB entry 1g2f

View 1g2f on RCSB PDB site
Description: structure of a cys2his2 zinc finger/tata box complex (tatazf;clone #6)
Class: transcription/DNA
Keywords: phage display, zinc finger-DNA complex, TATA box, Cys2His2, TRANSCRIPTION-DNA COMPLEX
Deposited on 2000-10-18, released 2001-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-d(*gp*ap*cp*gp*cp*tp*ap*tp*ap*ap*ap*ap*gp*gp*ap*g)-3'
  • Chain 'B':
    Compound: 5'-d(*tp*cp*cp*tp*tp*tp*tp*ap*tp*ap*gp*cp*gp*tp*cp*c)-3'
  • Chain 'C':
    Compound: tata box zinc finger protein
    Species: Mus musculus, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1g2fc_
  • Chain 'D':
    Compound: 5'-d(*gp*ap*cp*gp*cp*tp*ap*tp*ap*ap*ap*ap*gp*gp*ap*g)-3'
  • Chain 'E':
    Compound: 5'-d(*tp*cp*cp*tp*tp*tp*tp*ap*tp*ap*gp*cp*gp*tp*cp*c)-3'
  • Chain 'F':
    Compound: tata box zinc finger protein
    Species: Mus musculus, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1g2ff_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g2fC (C:)
    merpyacpvescdrrfsqktnldthirihtgqkpfqcricmrnfsqqaslnahirthtge
    kpfacdicgrkfatlhtrtrhtkihlrqkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g2fC (C:)
    merpyacpvescdrrfsqktnldthirihtgqkpfqcricmrnfsqqaslnahirthtge
    kpfacdicgrkfatlhtrtrhtkihlrqk
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1g2fF (F:)
    merpyacpvescdrrfsqktnldthirihtgqkpfqcricmrnfsqqaslnahirthtge
    kpfacdicgrkfatlhtrtrhtkihlrqkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g2fF (F:)
    erpyacpvescdrrfsqktnldthirihtgqkpfqcricmrnfsqqaslnahirthtgek
    pfacdicgrkfatlhtrtrhtkihlrq