PDB entry 1g2e

View 1g2e on RCSB PDB site
Description: crystal structure of hud and au-rich element of the tumor necrosis factor alpha rna
Deposited on 2000-10-18, released 2001-02-05
The last revision prior to the SCOP 1.65 freeze date was dated 2001-02-05, with a file datestamp of 2001-02-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.174
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g2eA (A:)
    sktnlivnylpqnmtqeefrslfgsigeiescklvrdkitgqslgygfvnyidpkdaeka
    intlnglrlqtktikvsyarpssasirdanlyvsglpktmtqkeleqlfsqygriitsri
    lvdqvtgvsrgvgfirfdkrieaeeaikglngqkpsgatepitvkfa