PDB entry 1g2b

View 1g2b on RCSB PDB site
Description: alpha-spectrin src homology 3 domain, circular permutant, cut at n47-d48
Class: metal binding protein
Keywords: capping protein, calcium-binding, duplication, repeat, sh3 domain, cytoskeleton
Deposited on 2000-10-18, released 2000-11-01
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.12 Å
R-factor: 0.148
AEROSPACI score: -0.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spectrin alpha chain
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07751 (18-61)
      • see remark 999 (0)
      • see remark 999 (16-17)
    Domains in SCOP 1.75: d1g2ba_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g2bA (A:)
    mdrqgfvpaayvkkldsgtgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkve
    vn