PDB entry 1g2b

View 1g2b on RCSB PDB site
Description: alpha-spectrin src homology 3 domain, circular permutant, cut at n47- d48
Deposited on 2000-10-18, released 2000-11-01
The last revision prior to the SCOP 1.67 freeze date was dated 2001-02-07, with a file datestamp of 2001-02-07.
Experiment type: XRAY
Resolution: 1.12 Å
R-factor: 0.148
AEROSPACI score: -1.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1g2ba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g2bA (A:)
    mdrqgfvpaayvkkldsgtgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkve
    vn