PDB entry 1g2b

View 1g2b on RCSB PDB site
Description: alpha-spectrin src homology 3 domain, circular permutant, cut at n47-d48
Class: metal binding protein
Keywords: capping protein, calcium-binding, duplication, sh3 domain, cytoskeleton, metal binding protein
Deposited on 2000-10-18, released 2000-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.12 Å
R-factor: N/A
AEROSPACI score: -5.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spectrin alpha chain
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07751 (18-61)
      • see remark 999 (0)
      • see remark 999 (16-17)
    Domains in SCOPe 2.08: d1g2ba_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g2bA (A:)
    mdrqgfvpaayvkkldsgtgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkve
    vn