PDB entry 1g29

View 1g29 on RCSB PDB site
Description: malk
Class: sugar binding protein
Keywords: ATPase, active transport, maltose uptake and regulation, SUGAR BINDING PROTEIN
Deposited on 2000-10-18, released 2000-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: maltose transport protein malk
    Species: Thermococcus litoralis [TaxId:2265]
    Gene: malK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YGA6 (0-371)
      • see remark 999 (326)
    Domains in SCOPe 2.07: d1g2912, d1g2913, d1g2914
  • Chain '2':
    Compound: maltose transport protein malk
    Species: Thermococcus litoralis [TaxId:2265]
    Gene: malK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YGA6 (0-371)
      • see remark 999 (326)
    Domains in SCOPe 2.07: d1g2922, d1g2923, d1g2924
  • Heterogens: NH4, CL, NA, MG, POP, DIO, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g291 (1:)
    magvrlvdvwkvfgevtavremslevkdgefmillgpsgcgktttlrmiagleepsrgqi
    yigdklvadpekgifvppkdrdiamvfqsyalyphmtvydniafplklrkvprqeidqrv
    revaellgltellnrkprelsggqrqrvalgraivrkpqvflmdeplsnldaklrvrmra
    elkklqrqlgvttiyvthdqveamtmgdriavmnrgvlqqvgspdevydkpantfvagfi
    gsppmnfldaivtedgfvdfgefrlkllpdqfevlgelgyvgrevifgirpedlydamfa
    qvrvpgenlvravveivenlgserivrlrvggvtfvgsfrsesrvregvevdvvfdmkki
    hifdkttgkaif
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g292 (2:)
    magvrlvdvwkvfgevtavremslevkdgefmillgpsgcgktttlrmiagleepsrgqi
    yigdklvadpekgifvppkdrdiamvfqsyalyphmtvydniafplklrkvprqeidqrv
    revaellgltellnrkprelsggqrqrvalgraivrkpqvflmdeplsnldaklrvrmra
    elkklqrqlgvttiyvthdqveamtmgdriavmnrgvlqqvgspdevydkpantfvagfi
    gsppmnfldaivtedgfvdfgefrlkllpdqfevlgelgyvgrevifgirpedlydamfa
    qvrvpgenlvravveivenlgserivrlrvggvtfvgsfrsesrvregvevdvvfdmkki
    hifdkttgkaif