PDB entry 1g25

View 1g25 on RCSB PDB site
Description: solution structure of the n-terminal domain of the human tfiih mat1 subunit
Class: metal binding protein
Keywords: ring finger (c3hc4), metal binding protein
Deposited on 2000-10-17, released 2000-11-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cdk-activating kinase assembly factor mat1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1g25a_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g25A (A:)
mddqgcprckttkyrnpslklmvnvcghtlcescvdllfvrgagncpecgtplrksnfrv
qlfed