PDB entry 1g21

View 1g21 on RCSB PDB site
Description:
Deposited on 2000-10-16, released 2001-01-31
The last revision prior to the SCOP 1.59 freeze date was dated 2001-01-31, with a file datestamp of 2001-01-31.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.238
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1g21a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1g21b_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1g21c_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1g21d_
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1g21e_
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1g21f_
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1g21g_
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1g21h_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g21A (A:)
    sreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgcay
    agskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdiv
    fggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrce
    gfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrillee
    mglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptk
    tieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvi
    gayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsg
    ikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g21B (B:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g21C (C:)
    sreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgcay
    agskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdiv
    fggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrce
    gfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrillee
    mglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptk
    tieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvi
    gayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsg
    ikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g21D (D:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g21E (E:)
    mrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimema
    aeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddldf
    vfydvgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlggl
    icnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyra
    larkvvdnkllvipnpitmdeleellme
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g21F (F:)
    mrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimema
    aeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddldf
    vfydvgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlggl
    icnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyra
    larkvvdnkllvipnpitmdeleellm
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g21G (G:)
    mrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimema
    aeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddldf
    vfydvgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlggl
    icnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyra
    larkvvdnkllvipnpitmdeleellme
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g21H (H:)
    mrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimema
    aeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddldf
    vfydvgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlggl
    icnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyra
    larkvvdnkllvipnpitmdeleellme