PDB entry 1g20

View 1g20 on RCSB PDB site
Description: mgatp-bound and nucleotide-free structures of a nitrogenase protein complex between leu127del-fe protein and the mofe protein
Class: oxidoreductase
Keywords: nitrogen-fixation, Fe protein, MoFe protein, P-cluster and FeMo cofactor, OXIDOREDUCTASE
Deposited on 2000-10-16, released 2001-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1g20a_
  • Chain 'B':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1g20b_
  • Chain 'C':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1g20c_
  • Chain 'D':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1g20d_
  • Chain 'E':
    Compound: nitrogenase iron protein
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1g20e_
  • Chain 'F':
    Compound: nitrogenase iron protein
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1g20f_
  • Chain 'G':
    Compound: nitrogenase iron protein
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1g20g_
  • Chain 'H':
    Compound: nitrogenase iron protein
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1g20h_
  • Heterogens: CA, SF4, HCA, CFM, CLF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g20A (A:)
    mtgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtir
    gcayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqe
    kdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivp
    vrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssri
    lleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynff
    gptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrp
    rhvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdl
    igsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    asegaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g20A (A:)
    sreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgcay
    agskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdiv
    fggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrce
    gfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrillee
    mglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptk
    tieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvi
    gayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsg
    ikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g20B (B:)
    msqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqre
    altvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmte
    daavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefp
    vpfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvi
    krmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlek
    tkkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdsht
    wlhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknat
    vyigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlh
    rsttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g20B (B:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g20C (C:)
    mtgmsreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtir
    gcayagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqe
    kdivfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivp
    vrcegfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssri
    lleemglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynff
    gptktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrp
    rhvigayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdl
    igsgikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    asegaekvaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g20C (C:)
    sreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgcay
    agskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdiv
    fggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrce
    gfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrillee
    mglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptk
    tieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvi
    gayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsg
    ikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1g20D (D:)
    msqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqre
    altvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmte
    daavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefp
    vpfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvi
    krmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlek
    tkkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdsht
    wlhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknat
    vyigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlh
    rsttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g20D (D:)
    sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
    ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
    aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
    pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
    rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
    kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
    lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
    yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
    sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1g20E (E:)
    mamrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntime
    maaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddl
    dfvfydvgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g20E (E:)
    mrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilntimemaaeagt
    vedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayldfvfydvgdv
    vcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlgglicnsrnte
    deliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyralarkvvdnkl
    lvipnpitmdeleellmef
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1g20F (F:)
    mamrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntime
    maaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddl
    dfvfydvgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g20F (F:)
    mrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilntimemaaeagt
    vedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddldfvfydv
    gdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlgglicnsr
    edeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyralarkvvdnk
    llvipnpitmdeleellmef
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1g20G (G:)
    mamrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntime
    maaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddl
    dfvfydvgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g20G (G:)
    mrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilntimemaaeagt
    vedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayldfvfydvgdv
    vcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlgglicnsrede
    liialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyralarkvvdnkllv
    ipnpitmdeleellmef
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1g20H (H:)
    mamrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntime
    maaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddl
    dfvfydvgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g20H (H:)
    mrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhntimemaaeag
    tvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddldfvfyd
    vgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlgglicns
    rredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyralarkvvd
    nkllvipnpitmdeleellmef