PDB entry 1g1z

View 1g1z on RCSB PDB site
Description: NMR Solution Structures of delta-Conotoxin EVIA from Conus ermineus that Selectively Acts on Vertebrate Neuronal Na+ Channels, LEU12-PRO13 Cis isomer
Class: toxin
Keywords: three disulfide linkages, cis/trans isomerism of Leu12-Pro13 peptide bond, hydroxyproline, TOXIN
Deposited on 2000-10-16, released 2000-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: conotoxin evia
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60513 (0-31)
  Domains in SCOPe 2.08: d1g1za_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g1zA (A:)
  ddcikpygfcslpilknglccsgacvgvcadl