PDB entry 1g1x

View 1g1x on RCSB PDB site
Description: structure of ribosomal proteins s15, s6, s18, and 16s ribosomal RNA
Class: ribosome
Keywords: ribosomal proteins S15, S6, S18, S30 ribosomal subunit, RNA, ribosome
Deposited on 2000-10-13, released 2000-10-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.266
AEROSPACI score: -1.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S6
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1g1xa_
  • Chain 'B':
    Compound: 30S ribosomal protein S15
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJ76 (0-87)
      • conflict (78-80)
      • conflict (85)
    Domains in SCOPe 2.02: d1g1xb_
  • Chain 'C':
    Compound: 30S ribosomal protein S18
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1g1xc_
  • Chain 'D':
    Compound: 16S ribosomal RNA
  • Chain 'E':
    Compound: 16S ribosomal RNA
  • Chain 'F':
    Compound: 30S ribosomal protein S6
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1g1xf_
  • Chain 'G':
    Compound: 30S ribosomal protein S15
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJ76 (0-87)
      • conflict (78-80)
      • conflict (85)
    Domains in SCOPe 2.02: d1g1xg_
  • Chain 'H':
    Compound: 30S ribosomal protein S18
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1g1xh_
  • Chain 'I':
    Compound: 16S ribosomal RNA
  • Chain 'J':
    Compound: 16S ribosomal RNA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g1xA (A:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepfl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g1xB (B:)
    pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyreiveklglrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g1xC (C:)
    mstknakpkkeaqrrpsrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsg
    keqrilaktikrarilgllpfteklvrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g1xC (C:)
    dlrdyrnvevlkrflilprtglsgkeqrilaktikrarilgllpft
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g1xF (F:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepfl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g1xG (G:)
    pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyreiveklglrg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1g1xH (H:)
    mstknakpkkeaqrrpsrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsg
    keqrilaktikrarilgllpfteklvrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g1xH (H:)
    dlrdyrnvevlkrflskilprtglsgkeqrilaktikrarilgllpft
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.