PDB entry 1g1x

View 1g1x on RCSB PDB site
Description:
Deposited on 2000-10-13, released 2000-10-30
The last revision prior to the SCOP 1.61 freeze date was dated 2000-10-30, with a file datestamp of 2000-10-30.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.266
AEROSPACI score: -1.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1g1xa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1g1xb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1g1xc_
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1g1xf_
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1g1xg_
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1g1xh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g1xA (A:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepfl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g1xB (B:)
    pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyreiveklglrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g1xC (C:)
    dlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrarilgllpft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g1xC (C:)
    dlrdyrnvevlkrflilprtglsgkeqrilaktikrarilgllpft
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g1xF (F:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepfl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g1xG (G:)
    pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyreiveklglrg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1g1xH (H:)
    dlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrarilgllpft
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g1xH (H:)
    dlrdyrnvevlkrflskilprtglsgkeqrilaktikrarilgllpft