PDB entry 1g1o

View 1g1o on RCSB PDB site
Description: crystal structure of the highly amyloidogenic transthyretin mutant ttr g53s/e54d/l55s
Class: transport protein
Keywords: Greek key, Beta barrel, beta-slip, TRANSPORT PROTEIN
Deposited on 2000-10-13, released 2001-10-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.238
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (52-54)
    Domains in SCOPe 2.03: d1g1oa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (52-54)
    Domains in SCOPe 2.03: d1g1ob_
  • Chain 'C':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (52-54)
    Domains in SCOPe 2.03: d1g1oc_
  • Chain 'D':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (52-54)
    Domains in SCOPe 2.03: d1g1od_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g1oA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsessdshgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g1oA (A:)
    plmvkvldavrgspainvavhvfrkaaddtwepfasgktsessdshgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g1oB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsessdshgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g1oB (B:)
    plmvkvldavrgspainvavhvfrkaaddtwepfasgktsessdshgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g1oC (C:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsessdshgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g1oC (C:)
    lmvkvldavrgspainvavhvfrkaaddtwepfasgktsessdshgltteeefvegiykv
    eidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1g1oD (D:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsessdshgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g1oD (D:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsessdshgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp