PDB entry 1g1k

View 1g1k on RCSB PDB site
Description: cohesin module from the cellulosome of clostridium cellulolyticum
Class: structural protein
Keywords: Beta -Barrel, structural protein
Deposited on 2000-10-12, released 2000-11-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.23
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: scaffolding protein
    Species: Clostridium cellulolyticum [TaxId:1521]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45996 (0-141)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d1g1ka1, d1g1ka2
  • Chain 'B':
    Compound: scaffolding protein
    Species: Clostridium cellulolyticum [TaxId:1521]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45996 (0-141)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d1g1kb1, d1g1kb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g1kA (A:)
    aslkvtvgtangkpgdtvtvpvtfadvakmknvgtcnfylgydasllevvsvdagpivkn
    aavnfsssasngtisflfldntitdelitadgvfanikfklksvtaktttpvtfkdggaf
    gdgtmskiasvtktngsvtidpg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g1kB (B:)
    aslkvtvgtangkpgdtvtvpvtfadvakmknvgtcnfylgydasllevvsvdagpivkn
    aavnfsssasngtisflfldntitdelitadgvfanikfklksvtaktttpvtfkdggaf
    gdgtmskiasvtktngsvtidpg