PDB entry 1g1j

View 1g1j on RCSB PDB site
Description: crystal structure of the oligomerization domain from rotavirus nsp4
Deposited on 2000-10-11, released 2001-01-10
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.216
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non-structural glycoprotein nsp4
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot O92323 (0-42)
      • modified residue (17)
  • Chain 'B':
    Compound: non-structural glycoprotein nsp4
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot O92323 (0-42)
      • modified residue (17)
  • Heterogens: SR, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.57, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1g1jA (A:)
    iekqmdrvvkemrrqlemidklttreieqvellkriydkltvq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1g1jB (B:)
    iekqmdrvvkemrrqlemidklttreieqvellkriydkltvq