PDB entry 1g19

View 1g19 on RCSB PDB site
Description: structure of reca protein
Deposited on 2000-10-11, released 2000-12-11
The last revision prior to the SCOP 1.57 freeze date was dated 2001-01-03, with a file datestamp of 2001-01-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.217
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g19A (A:)
    mtqtpdrekalelavaqieksygkgsvmrlgdearqpisviptgsialdvalgigglprg
    rvieiygpessgkttvalhavanaqaaggvaafidaehaldpdyakklgvdtdsllvsqp
    dtgeqaleiadmlirsgaldivvidsvaalvpraelegemgdshvglqarlmsqalrkmt
    galnnsgttaifinqlrdkigvmfgspetttggkalkfyasvrmdvrrvetlkdgtnavg
    nrtrvkvvknkclapfkqaefdilygkgisregslidmgvdqglirksgawftyegeqlg
    qgkenarnflvenadvadeiekkikeklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g19A (A:)
    mtqtpdrekalelavaqieksygkgsvmrlgdearqpisviptgsialdvalgigglprg
    rvieiygpessgkttvalhavanaqaaggvaafidaehaldpdyakklgvdtdsllvsqp
    dtgeqaleiadmlirsgaldivvidsvaalvpraelegehvglqarlmsqalrkmtgaln
    nsgttaifinqltggkalkfyasvrmdvrrvetlkdgtnavgnrtrvkvvknkclapfkq
    aefdilygkgisregslidmgvdqglirksgawftyegeqlgqgkenarnflvenadvad
    eiekkikeklg