PDB entry 1g19

View 1g19 on RCSB PDB site
Description: structure of reca protein
Class: hydrolase
Keywords: RECOMBINATION, DNA-REPAIR, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, hydrolase
Deposited on 2000-10-11, released 2000-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.217
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: reca protein
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g19a1, d1g19a2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g19A (A:)
    mtqtpdrekalelavaqieksygkgsvmrlgdearqpisviptgsialdvalgigglprg
    rvieiygpessgkttvalhavanaqaaggvaafidaehaldpdyakklgvdtdsllvsqp
    dtgeqaleiadmlirsgaldivvidsvaalvpraelegemgdshvglqarlmsqalrkmt
    galnnsgttaifinqlrdkigvmfgspetttggkalkfyasvrmdvrrvetlkdgtnavg
    nrtrvkvvknkclapfkqaefdilygkgisregslidmgvdqglirksgawftyegeqlg
    qgkenarnflvenadvadeiekkikeklgigavvtddpsndgvlpapvdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g19A (A:)
    mtqtpdrekalelavaqieksygkgsvmrlgdearqpisviptgsialdvalgigglprg
    rvieiygpessgkttvalhavanaqaaggvaafidaehaldpdyakklgvdtdsllvsqp
    dtgeqaleiadmlirsgaldivvidsvaalvpraelegehvglqarlmsqalrkmtgaln
    nsgttaifinqltggkalkfyasvrmdvrrvetlkdgtnavgnrtrvkvvknkclapfkq
    aefdilygkgisregslidmgvdqglirksgawftyegeqlgqgkenarnflvenadvad
    eiekkikeklg