PDB entry 1g15

View 1g15 on RCSB PDB site
Description: co-crystal of e. coli RNAse hi with two mn2+ ions bound in the the active site
Class: hydrolase
Keywords: ribonuclease H, RNase H, nuclease, divalent metal binding, activation/attenuation mechanism, HYDROLASE
Deposited on 2000-10-10, released 2001-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.223
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease hi
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Y4
      • engineered (12)
      • engineered (62)
      • engineered (86)
      • engineered (132)
    Domains in SCOPe 2.08: d1g15a_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1g15A (A:)
mlkqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
ehaevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwew
vkghaghpeneradelaraaamnptledtgyqvev

    Sequence, based on observed residues (ATOM records): (download) 
    >1g15A (A:)
kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealkeh
aevilstdsqyvrqgitqwihnwkargwkpvknvdlwqrldaalgqhqikwewvghpene
radelaraaamnptledtgyq