PDB entry 1g13

View 1g13 on RCSB PDB site
Description: human gm2 activator structure
Class: Ligand Binding Protein
Keywords: beta cup, Ligand Binding Protein
Deposited on 2000-10-10, released 2001-04-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ganglioside m2 activator protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17900 (0-161)
      • modified residue (37)
      • modified residue (85)
    Domains in SCOPe 2.08: d1g13a_
  • Chain 'B':
    Compound: ganglioside m2 activator protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17900 (0-161)
      • modified residue (37)
      • modified residue (85)
    Domains in SCOPe 2.08: d1g13b_
  • Chain 'C':
    Compound: ganglioside m2 activator protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17900 (0-161)
      • modified residue (37)
      • modified residue (85)
    Domains in SCOPe 2.08: d1g13c_
  • Heterogens: EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g13A (A:)
ssfswdncdegkdpavirsltlepdpiivpgnvtlsvmgstsvplssplkvdlvlekeva
glwikipctdyigsctfehfcdvldmliptgepcpeplrtyglpchcpfkegtyslpkse
fvvpdlelpswlttgnyriesvlsssgkrlgcikiaaslkgi

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g13B (B:)
ssfswdncdegkdpavirsltlepdpiivpgnvtlsvmgstsvplssplkvdlvlekeva
glwikipctdyigsctfehfcdvldmliptgepcpeplrtyglpchcpfkegtyslpkse
fvvpdlelpswlttgnyriesvlsssgkrlgcikiaaslkgi

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g13C (C:)
ssfswdncdegkdpavirsltlepdpiivpgnvtlsvmgstsvplssplkvdlvlekeva
glwikipctdyigsctfehfcdvldmliptgepcpeplrtyglpchcpfkegtyslpkse
fvvpdlelpswlttgnyriesvlsssgkrlgcikiaaslkgi