PDB entry 1g11

View 1g11 on RCSB PDB site
Description: toluene-4-monooxygenase catalytic effector protein nmr structure
Class: oxidoreductase
Keywords: aromatic hydrocarbon catabolism, oxidoreductase, monooxygenase, toluene oxidation
Deposited on 2000-10-10, released 2001-05-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toluene-4-monooxygenase catalytic effector
    Species: PSEUDOMONAS MENDOCINA [TaxId:300]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1g11a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g11A (A:)
    stladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltr
    ktleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm