PDB entry 1g0z

View 1g0z on RCSB PDB site
Description: specific mutations in krait pla2 lead to dimerization of protein molecules: crystal structure of krait pla2 at 2.1 resolution
Deposited on 2000-10-10, released 2003-06-17
The last revision prior to the SCOP 1.67 freeze date was dated 2003-06-17, with a file datestamp of 2003-06-17.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.199
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1g0za_
  • Chain 'B':
    Domains in SCOP 1.67: d1g0zb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0zA (A:)
    nlkqfknmiqcagtrtwtsyigygcycgyggsgtpvdeldrccythdhcynkaanipgcn
    pliktysytctkpnitcndtsdscarficdcdrtaaicfasapyninnimisastscq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0zB (B:)
    nlkqfknmiqcagtrtwtsyigygcycgyggsgtpvdeldrccythdhcynkaanipgcn
    pliktysytctkpnitcndtsdscarficdcdrtaaicfasapyninnimisastscq