PDB entry 1g0z

View 1g0z on RCSB PDB site
Description: specific mutations in krait pla2 lead to dimerization of protein molecules: crystal structure of krait pla2 at 2.1 resolution
Class: toxin
Keywords: Phospholipase A2, Homodimer, Bungarus caeruleus, TOXIN
Deposited on 2000-10-10, released 2003-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Bungarus caeruleus [TaxId:132961]
    Database cross-references and differences (RAF-indexed):
    • PDB 1G0Z (0-117)
    Domains in SCOPe 2.08: d1g0za_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Bungarus caeruleus [TaxId:132961]
    Database cross-references and differences (RAF-indexed):
    • PDB 1G0Z (0-117)
    Domains in SCOPe 2.08: d1g0zb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0zA (A:)
    nlkqfknmiqcagtrtwtsyigygcycgyggsgtpvdeldrccythdhcynkaanipgcn
    pliktysytctkpnitcndtsdscarficdcdrtaaicfasapyninnimisastscq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0zB (B:)
    nlkqfknmiqcagtrtwtsyigygcycgyggsgtpvdeldrccythdhcynkaanipgcn
    pliktysytctkpnitcndtsdscarficdcdrtaaicfasapyninnimisastscq