PDB entry 1g0z
View 1g0z on RCSB PDB site
Description: specific mutations in krait pla2 lead to dimerization of protein molecules: crystal structure of krait pla2 at 2.1 resolution
Class: toxin
Keywords: Phospholipase A2, Homodimer, Bungarus caeruleus, TOXIN
Deposited on
2000-10-10, released
2003-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-04, with a file datestamp of
2017-09-29.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.26
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: phospholipase a2
Species: Bungarus caeruleus [TaxId:132961]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1g0za_ - Chain 'B':
Compound: phospholipase a2
Species: Bungarus caeruleus [TaxId:132961]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1g0zb_ - Heterogens: CL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1g0zA (A:)
nlkqfknmiqcagtrtwtsyigygcycgyggsgtpvdeldrccythdhcynkaanipgcn
pliktysytctkpnitcndtsdscarficdcdrtaaicfasapyninnimisastscq
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1g0zB (B:)
nlkqfknmiqcagtrtwtsyigygcycgyggsgtpvdeldrccythdhcynkaanipgcn
pliktysytctkpnitcndtsdscarficdcdrtaaicfasapyninnimisastscq