PDB entry 1g0x

View 1g0x on RCSB PDB site
Description: crystal structure of the ligand binding domain of lir-1 (ilt2)
Class: immune system
Keywords: Immunoglobulin fold, 3-10 helix, immune system
Deposited on 2000-10-09, released 2001-01-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.214
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leucocyte immunoglobulin-like receptor-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1g0xa1, d1g0xa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g0xA (A:)
    hlpkptlwaepgsvitqgspvtlrcqggqetqeyrlyrekktapwitripqelvkkgqfp
    ipsitwehagryrcyygsdtagrsessdplelvvtgayikptlsaqpspvvnsggnvtlq
    cdsqvafdgfilckegedehpqclnsqphargssraifsvgpvspsrrwwyrcyaydsns
    pyewslpsdllellvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g0xA (A:)
    hlpkptlwaepgsvitqgspvtlrcqgtqeyrlyrekktapwitripqelvkkgqfpips
    itwehagryrcyygsdtagrsessdplelvvtgayikptlsaqpspvvnsggnvtlqcds
    qvafdgfilckegehpqclnsqphargssraifsvgpvspsrrwwyrcyaydsnspyews
    lpsdllellvlg