PDB entry 1g0w

View 1g0w on RCSB PDB site
Description: crystal structure of bovine retinal creatine kinase
Class: transferase
Keywords: brain-type creatine kinase, GUANIDINO KINASE CELLULAR ENERGY METABOLISM, TRANSFERASE
Deposited on 2000-10-09, released 2001-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.197
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creatine kinase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g0wa1, d1g0wa2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g0wA (A:)
    pfsnshntlklrfpaedefpdlsghnnhmakvltpelyaelrakstpsgftvddviqtgv
    dnpghpyimtvgcvagdeesydvfkelfdpiiedrhggykptdehktdlnpdnlqggddl
    dpnyvlssrvrtgrsirgfclpphcsrgerraieklavealssldgdlagryyalksmte
    aeqqqliddhflfdkpvsplllasgmardwpdargiwhndnktflvwineedhlrvismq
    kggnmkevftrfcngltqietlfksknyefmwnphlgyiltcpsnlgtglragvhiklph
    lgkhekfsevlkrlrlqkrgtggvdtaavggvfdvsnadrlgfsevelvqmvvdgvklli
    emeqrleqgqaiddlmpaqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g0wA (A:)
    pfsnshntlklrfpaedefpdlsghnnhmakvltpelyaelrakstpsgftvddviqtgv
    dnpghpyimtvgcvagdeesydvfkelfdpiiedrhggykptdehktdlnpdnlqggddl
    dpnyvlssrvrtgrsirgfclpphcsrgerraieklavealssldgdlagryyalksmte
    aeqqqliddhflfdkpvsplllasgmardwpdargiwhndnktflvwineedhlrvismq
    kggnmkevftrfcngltqietlfksknyefmwnphlgyiltcpsnlgtglragvhiklph
    lgkhekfsevlkrlrlqkrgvggvfdvsnadrlgfsevelvqmvvdgvklliemeqrleq
    gqaiddlmpaqk