PDB entry 1g0v

View 1g0v on RCSB PDB site
Description: the structure of proteinase a complexed with a ia3 mutant, mvv
Class: hydrolase/hydrolase inhibitor
Keywords: Proteinase A, MVV, hydrolase-hydrolase inhibitor COMPLEX
Deposited on 2000-10-09, released 2001-04-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proteinase a
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07267 (1-328)
      • conflict (243)
    Domains in SCOPe 2.05: d1g0va_
  • Chain 'B':
    Compound: protease a inhibitor 3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01094 (Start-30)
      • engineered (23)
    Domains in SCOPe 2.05: d1g0vb_
  • Heterogens: MAN, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0vA (A:)
    gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
    asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
    ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk
    gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga
    kkgstgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp
    laivgdaflrkyysiydlgnnavglakai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g0vB (B:)
    mntdqqkvseifqsskeklqgdamvvsdafk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g0vB (B:)
    tdqqkvseifqsskeklqgdamvvsdafk