PDB entry 1g0o

View 1g0o on RCSB PDB site
Description: structure of trihydroxynaphthalene reductase in complex with nadph and pyroquilon
Class: oxidoreductase/oxidoreductase INHIBITOR
Keywords: Protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase, short chain dehydrogenase, oxidoreductase-oxidoreductase INHIBITOR complex
Deposited on 2000-10-06, released 2001-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.176
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trihydroxynaphthalene reductase
    Species: Magnaporthe grisea [TaxId:148305]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12634 (Start-282)
      • engineered (240-241)
      • engineered (246)
    Domains in SCOPe 2.07: d1g0oa_
  • Chain 'B':
    Compound: trihydroxynaphthalene reductase
    Species: Magnaporthe grisea [TaxId:148305]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12634 (Start-282)
      • engineered (240-241)
      • engineered (246)
    Domains in SCOPe 2.07: d1g0ob_
  • Chain 'C':
    Compound: trihydroxynaphthalene reductase
    Species: Magnaporthe grisea [TaxId:148305]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12634 (Start-282)
      • engineered (240-241)
      • engineered (246)
    Domains in SCOPe 2.07: d1g0oc_
  • Chain 'D':
    Compound: trihydroxynaphthalene reductase
    Species: Magnaporthe grisea [TaxId:148305]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12634 (Start-282)
      • engineered (240-241)
      • engineered (246)
    Domains in SCOPe 2.07: d1g0od_
  • Heterogens: NDP, PYQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g0oA (A:)
    mpavtqprgeskydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivny
    anstesaeevvaaikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsf
    ghvkdvtpeefdrvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysg
    skgaietfarcmaidmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaa
    vqwsplrrvglpidiarvvcflasndggwvtgkvigidggacm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g0oA (A:)
    kydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivnyanstesaeevv
    aaikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsfghvkdvtpeef
    drvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysgskgaietfarc
    maidmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaavqwsplrrvgl
    pidiarvvcflasndggwvtgkvigidggacm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1g0oB (B:)
    mpavtqprgeskydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivny
    anstesaeevvaaikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsf
    ghvkdvtpeefdrvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysg
    skgaietfarcmaidmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaa
    vqwsplrrvglpidiarvvcflasndggwvtgkvigidggacm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g0oB (B:)
    kydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivnyanstesaeevv
    aaikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsfghvkdvtpeef
    drvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysgskgaietfarc
    maidmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaavqwsplrrvgl
    pidiarvvcflasndggwvtgkvigidggacm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1g0oC (C:)
    mpavtqprgeskydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivny
    anstesaeevvaaikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsf
    ghvkdvtpeefdrvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysg
    skgaietfarcmaidmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaa
    vqwsplrrvglpidiarvvcflasndggwvtgkvigidggacm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g0oC (C:)
    avtqprgeskydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivnyan
    stesaeevvaaikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsfgh
    vkdvtpeefdrvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysgsk
    gaietfarcmaidmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaavq
    wsplrrvglpidiarvvcflasndggwvtgkvigidggacm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1g0oD (D:)
    mpavtqprgeskydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivny
    anstesaeevvaaikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsf
    ghvkdvtpeefdrvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysg
    skgaietfarcmaidmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaa
    vqwsplrrvglpidiarvvcflasndggwvtgkvigidggacm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g0oD (D:)
    avtqprgeskydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivnyan
    stesaeevvaaikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsfgh
    vkdvtpeefdrvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysgsk
    gaietfarcmaidmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaavq
    wsplrrvglpidiarvvcflasndggwvtgkvigidggacm