PDB entry 1g0c

View 1g0c on RCSB PDB site
Description: alkaline cellulase k catalytic domain-cellobiose complex
Class: hydrolase
Keywords: Alpha/beta barrel, TIM-barrel, cellobiose complex, HYDROLASE
Deposited on 2000-10-05, released 2001-08-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.181
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: Bacillus sp. [TaxId:1415]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19424 (7-End)
      • cloning artifact (2-6)
    Domains in SCOPe 2.06: d1g0ca1, d1g0ca2
  • Heterogens: CBI, CD, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g0cA (A:)
    grpagmqavkspseagalqlvelngqltlagedgtpvqlrgmsthglqwfgeivnenafv
    alsndwgsnmirlamyigengyatnpevkdlvyegielafehdmyvivdwhvhapgdpra
    dvysgaydffeeiadhykdhpknhyiiwelanepspnnnggpgltndekgweavkeyaep
    ivemlrekgdnmilvgnpnwsqrpdlsadnpidaenimysvhfytgshgashigypegtp
    ssersnvmanvryaldngvavfatewgtsqangdggpyfdeadvwlnflnkhniswanws
    ltnkneisgaftpfelgrtdatdldpganqvwapeelslsgeyvrarikgieytpidrtk
    ftkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g0cA (A:)
    pagmqavkspseagalqlvelngqltlagedgtpvqlrgmsthglqwfgeivnenafval
    sndwgsnmirlamyigengyatnpevkdlvyegielafehdmyvivdwhvhapgdpradv
    ysgaydffeeiadhykdhpknhyiiwelanepspnnnggpgltndekgweavkeyaepiv
    emlrekgdnmilvgnpnwsqrpdlsadnpidaenimysvhfytgshgashigypegtpss
    ersnvmanvryaldngvavfatewgtsqangdggpyfdeadvwlnflnkhniswanwslt
    nkneisgaftpfelgrtdatdldpganqvwapeelslsgeyvrarikgieytpidrtk