PDB entry 1g0a

View 1g0a on RCSB PDB site
Description: carbonmonoxy liganded bovine hemoglobin ph 8.5
Class: oxygen storage/transport
Keywords: bovine, hemoglobin, liganded, carbonmonoxy, protoporphyrin IX, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2000-10-05, released 2000-12-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.189
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin alpha chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1g0aa_
  • Chain 'B':
    Compound: hemoglobin beta chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1g0ab_
  • Chain 'C':
    Compound: hemoglobin alpha chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1g0ac_
  • Chain 'D':
    Compound: hemoglobin beta chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1g0ad_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0aA (A:)
    vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
    kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
    vhasldkflanvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0aB (B:)
    mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
    ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
    ftpvlqadfqkvvagvanalahryh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0aC (C:)
    vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
    kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
    vhasldkflanvstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g0aD (D:)
    mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
    ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
    ftpvlqadfqkvvagvanalahryh