PDB entry 1g06

View 1g06 on RCSB PDB site
Description: crystal structure of t4 lysozyme mutant v149s
Class: hydrolase
Keywords: Hydrolase, O-Glycosyl, Glycosidase, Bacteriolytic Enzyme
Deposited on 2000-10-05, released 2001-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (lysozyme)
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • engineered (53)
      • engineered (96)
      • engineered (148)
    Domains in SCOPe 2.07: d1g06a_
  • Heterogens: CL, HED, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1g06A (A:)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrsittfrtgtwdayknl