PDB entry 1fzy

View 1fzy on RCSB PDB site
Description: crystal structure of saccharomyces cerevisiae ubiquitin conjugating enzyme 1
Class: ligase
Keywords: alpha-beta roll, ligase
Deposited on 2000-10-04, released 2001-10-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.209
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme e2-24 kda
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1fzya_
  • Chain 'B':
    Compound: ubiquitin-conjugating enzyme e2-24 kda
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1fzyb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fzyA (A:)
srakrimkeiqavkddpaahitlefvsesdihhlkgtflgppgtpyeggkfvvdievpme
ypfkppkmqfdtkvyhpnissvtgaicldilknawspvitlksalislqallqspepndp
qdaevaqhylrdresfnktaalwtrlyas

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fzyB (B:)
srakrimkeiqavkddpaahitlefvsesdihhlkgtflgppgtpyeggkfvvdievpme
ypfkppkmqfdtkvyhpnissvtgaicldilknawspvitlksalislqallqspepndp
qdaevaqhylrdresfnktaalwtrlyas