PDB entry 1fzv

View 1fzv on RCSB PDB site
Description: the crystal structure of human placenta growth factor-1 (plgf-1), an angiogenic protein at 2.0a resolution
Class: hormone/growth factor
Keywords: cysteine-knot family, growth factor, angiogenesis
Deposited on 2000-10-04, released 2001-05-09
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: placenta growth factor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49763
      • conflict (73)
    Domains in SCOP 1.75: d1fzva_
  • Chain 'B':
    Compound: placenta growth factor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49763
      • conflict (73)
    Domains in SCOP 1.75: d1fzvb_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fzvA (A:)
    mlpavppqqwalsagngssevevvpfqevwgrsycralerlvdvvseypsevehmfspsc
    vsllrctgccgdenlhcvpvetanvtmqllkirsgdrpsyveltfsqhvrcecrplrekm
    kpercgdavprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzvA (A:)
    ssevevvpfqevwgrsycralerlvdvvseypsevehmfspscvsllrctgccgdenlhc
    vpvetanvtmqllkirsgdrpsyveltfsqhvrcecrplr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fzvB (B:)
    mlpavppqqwalsagngssevevvpfqevwgrsycralerlvdvvseypsevehmfspsc
    vsllrctgccgdenlhcvpvetanvtmqllkirsgdrpsyveltfsqhvrcecrplrekm
    kpercgdavprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzvB (B:)
    ssevevvpfqevwgrsycralerlvdvvseypsevehmfspscvsllrctgccgdenlhc
    vpvetanvtmqllkirsgdrpsyveltfsqhvrcecrplr