PDB entry 1fzt

View 1fzt on RCSB PDB site
Description: solution structure and dynamics of an open b-sheet, glycolytic enzyme- monomeric 23.7 kda phosphoglycerate mutase from schizosaccharomyces pombe
Deposited on 2000-10-04, released 2001-03-14
The last revision prior to the SCOP 1.59 freeze date was dated 2001-03-14, with a file datestamp of 2001-03-14.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1fzta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fztA (A:)
    mtteaapnllvltrhgesewnklnlftgwkdpalsetgikeaklggerlksrgykfdiaf
    tsalqraqktcqiileevgepnletikseklneryygdlqglnkddarkkwgaeqvqiwr
    rsydiappngeslkdtaervlpyykstivphilkgekvliaahgnslralimdlegltgd
    qivkrelatgvpivyhldkdgkyvskelidn