PDB entry 1fzt

View 1fzt on RCSB PDB site
Description: solution structure and dynamics of an open b-sheet, glycolytic enzyme-monomeric 23.7 kda phosphoglycerate mutase from schizosaccharomyces pombe
Class: isomerase
Keywords: open B-sheet-helices, ISOMERASE
Deposited on 2000-10-04, released 2001-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate mutase
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fzta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fztA (A:)
    mtteaapnllvltrhgesewnklnlftgwkdpalsetgikeaklggerlksrgykfdiaf
    tsalqraqktcqiileevgepnletikseklneryygdlqglnkddarkkwgaeqvqiwr
    rsydiappngeslkdtaervlpyykstivphilkgekvliaahgnslralimdlegltgd
    qivkrelatgvpivyhldkdgkyvskelidn