PDB entry 1fzq

View 1fzq on RCSB PDB site
Description: crystal structure of murine arl3-GDP
Class: signaling protein
Keywords: Protein-GDP complex without magnesium, ARF family, Ras Superfamily, G-domain, SIGNALING PROTEIN
Deposited on 2000-10-04, released 2000-12-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.213
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor-like protein 3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1fzqa_
  • Heterogens: SO4, NH4, MES, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fzqA (A:)
    gllsilrklksapdqevrilllgldnagkttllkqlasedishitptqgfniksvqsqgf
    klnvwdiggqrkirpywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpv
    lifankqdlltaapaseiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknvnakk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzqA (A:)
    gllsilrklksapdqevrilllgldnagkttllkqlasedishitptqgfniksvqsqgf
    klnvwdiggqrkirpywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpv
    lifankqdlltaapaseiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknv