PDB entry 1fzp

View 1fzp on RCSB PDB site
Description: crystal structures of sara: a pleiotropic regulator of virulence genes in s. aureus
Class: transcription/DNA
Keywords: protein-DNA complex, indirect readout, D-DNA, conformational changes,coil to helix
Deposited on 2000-10-03, released 2001-01-22
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.23
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Staphylococcal accessory regulator A
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fzpb_
  • Chain 'D':
    Compound: Staphylococcal accessory regulator A
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fzpd_
  • Chain 'K':
    Compound: 5'-d(p*ap*tp*ap*tp*ap*tp*a)-3'
  • Chain 'W':
    Compound: 5'-d(p*ap*tp*ap*tp*ap*tp*a)-3'
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fzpB (B:)
    aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdiinhln
    ykqpqvvkavkilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrvnkriteanne
    iel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzpB (B:)
    aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdivvkav
    kilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrvnkrit
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fzpD (D:)
    aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdiinhln
    ykqpqvvkavkilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrvnkriteanne
    iel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fzpD (D:)
    aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdivvkav
    kilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrv
    

  • Chain 'K':
    No sequence available.

  • Chain 'W':
    No sequence available.