PDB entry 1fzo

View 1fzo on RCSB PDB site
Description: MHC class I natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and sendai virus nucleoprotein
Class: immune system
Keywords: major histocompatibility complex peptide-MHC, IMMUNE SYSTEM
Deposited on 2000-10-03, released 2001-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: h-2 class I histocompatibility antigen, k-b alpha chain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01901 (0-273)
    • engineered (21-23)
    • engineered (29)
    • modified residue (120)
  Domains in SCOPe 2.08: d1fzoa1, d1fzoa2
• Chain 'B':
  Compound: protein (beta-2-microglobulin)
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01887 (0-98)
  Domains in SCOPe 2.08: d1fzob_
• Chain 'P':
  Compound: protein (nucleocapsid protein)
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04857 (0-8)
• Heterogens: NAG, MRD, MPD, PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fzoA (A:)
  gphslryfvtavsrpglgeprfisvgyvdntefvrfdsdaenpryeprarwmeqegpeyw
  eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
  cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
  rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
  fqkwasvvvplgkeqyytchvyhqglpepltlrw
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fzoB (B:)
  iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
  sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
  

  
  
• Chain 'P':
  No sequence available.