PDB entry 1fzm

View 1fzm on RCSB PDB site
Description:
Deposited on 2000-10-03, released 2001-03-28
The last revision prior to the SCOP 1.69 freeze date was dated 2001-03-28, with a file datestamp of 2001-03-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.21
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1fzma1, d1fzma2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1fzmb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fzmA (A:)
    gphslryfvtavsrpglgeprfisvgyvdntefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fzmB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm