PDB entry 1fzk

View 1fzk on RCSB PDB site
Description: MHC class I natural mutant h-2kbm1 heavy chain complexed with beta-2 microglobulin and sendai virus nucleoprotein
Class: immune system
Keywords: major histocompatibility complex peptide-MHC, IMMUNE SYSTEM
Deposited on 2000-10-03, released 2001-03-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.204
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: h-2 class I histocompatibility antigen, k-b alpha chain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01901 (0-273)
    • modified residue (120)
    • engineered (151)
    • engineered (154-155)
  Domains in SCOPe 2.05: d1fzka1, d1fzka2
• Chain 'B':
  Compound: protein (beta-2-microglobulin)
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01887 (0-98)
  Domains in SCOPe 2.05: d1fzkb_
• Chain 'P':
  Compound: protein (nucleocapsid protein)
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04857 (0-8)
• Heterogens: NAG, PO4, MRD, MPD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fzkA (A:)
  gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
  eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
  cdyialnedlktwtaadmaalitkhkweqagaaeyyraylegtcvewlrrylkngnatll
  rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
  fqkwasvvvplgkeqyytchvyhqglpepltlrw
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fzkB (B:)
  iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
  sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
  

  
  
• Chain 'P':
  No sequence available.