PDB entry 1fzk

View 1fzk on RCSB PDB site
Description: MHC class I natural mutant h-2kbm1 heavy chain complexed with beta-2 microglobulin and sendai virus nucleoprotein
Class: immune system
Keywords: major histocompatibility complex peptide-MHC
Deposited on 2000-10-03, released 2001-03-28
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.204
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01901 (0-273)
      • modified residue (120)
      • engineered (151)
      • engineered (154-155)
    Domains in SCOP 1.73: d1fzka1, d1fzka2
  • Chain 'B':
    Compound: protein (beta-2-microglobulin)
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fzkb_
  • Chain 'P':
    Compound: protein (nucleocapsid protein)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, PO4, MRD, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fzkA (A:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqagaaeyyraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fzkB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'P':
    No sequence available.