PDB entry 1fzj

View 1fzj on RCSB PDB site
Description: mhc class i natural mutant h-2kbm1 heavy chain complexed with beta-2 microglobulin and vesicular stomatitis virus nucleoprotein
Deposited on 2000-10-03, released 2001-03-28
The last revision prior to the SCOP 1.67 freeze date was dated 2001-03-28, with a file datestamp of 2001-03-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fzjA (A:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqagaaeyyraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fzjB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm