PDB entry 1fzj

View 1fzj on RCSB PDB site
Description: MHC class I natural mutant h-2kbm1 heavy chain complexed with beta-2 microglobulin and vesicular stomatitis virus nucleoprotein
Class: immune system
Keywords: major histocompatibility complex peptide-MHC, IMMUNE SYSTEM
Deposited on 2000-10-03, released 2001-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: h-2 class I histocompatibility antigen, k-b alpha chain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01901 (0-273)
    • modified residue (120)
    • engineered (151)
    • engineered (154-155)
  Domains in SCOPe 2.08: d1fzja1, d1fzja2
• Chain 'B':
  Compound: Beta-2-microglobulin
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01887 (0-98)
  Domains in SCOPe 2.08: d1fzjb_
• Chain 'P':
  Compound: nucleocapsid protein
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11212 (0-7)
• Heterogens: NAG, PO4, MPD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fzjA (A:)
  gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
  eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
  cdyialnedlktwtaadmaalitkhkweqagaaeyyraylegtcvewlrrylkngnatll
  rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
  fqkwasvvvplgkeqyytchvyhqglpepltlrw
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fzjB (B:)
  iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
  sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
  

  
  
• Chain 'P':
  No sequence available.