PDB entry 1fz2

View 1fz2 on RCSB PDB site
Description:
Deposited on 2000-10-03, released 2001-02-21
The last revision prior to the SCOP 1.57 freeze date was dated 2001-02-21, with a file datestamp of 2001-02-21.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.191
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1fz2a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1fz2b_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1fz2c_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1fz2d_
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1fz2e_
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1fz2f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fz2A (A:)
    nraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkde
    rqfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkng
    ylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgd
    avecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvs
    iandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggi
    wigrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeany
    pgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastl
    rvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktli
    aqphvrgdklwtlddikrlncvfknpvkafn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fz2B (B:)
    raptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkder
    qfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkngy
    laqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgda
    vecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvsi
    andpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggiw
    igrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeanyp
    gwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastlr
    vheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktlia
    qphvrgdklwtlddikrlncvfknpvkafn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fz2C (C:)
    smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
    wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
    rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
    wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
    nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
    clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
    dwiedyasridfkadrdqivkavlaglk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fz2D (D:)
    smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
    wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
    rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
    wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
    nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
    clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
    dwiedyasridfkadrdqivkavlagl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fz2E (E:)
    klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
    kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
    mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fz2F (F:)
    klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
    kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
    mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsph