PDB entry 1fz1

View 1fz1 on RCSB PDB site
Description: methane monooxygenase hydroxylase, form III oxidized
Class: oxidoreductase
Keywords: dinuclear iron center, monooxygenase
Deposited on 2000-10-03, released 2001-02-21
The last revision prior to the SCOP 1.73 freeze date was dated 2001-02-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.2
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methane monooxygenase component a, alpha chain
    Species: Methylococcus capsulatus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fz1a_
  • Chain 'B':
    Compound: methane monooxygenase component a, alpha chain
    Species: Methylococcus capsulatus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fz1b_
  • Chain 'C':
    Compound: methane monooxygenase component a, beta chain
    Species: Methylococcus capsulatus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18798 (Start-388)
      • conflict (369)
    Domains in SCOP 1.73: d1fz1c_
  • Chain 'D':
    Compound: methane monooxygenase component a, beta chain
    Species: Methylococcus capsulatus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18798
      • conflict (369)
    Domains in SCOP 1.73: d1fz1d_
  • Chain 'E':
    Compound: methane monooxygenase component a, gamma chain
    Species: Methylococcus capsulatus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fz1e_
  • Chain 'F':
    Compound: methane monooxygenase component a, gamma chain
    Species: Methylococcus capsulatus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1fz1f_
  • Heterogens: FE, CA, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fz1A (A:)
    malstatkaatdalaanraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqf
    kliakeyarmeavkderqfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaa
    tgmlwdsaqaaeqkngylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigpl
    wkgmkrvfsdgfisgdavecslnlqlvgeacftnplivavtewaaangdeitptvflsie
    tdelrhmangyqtvvsiandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvep
    wvktwdrwvyedwggiwigrlgkygvesprslkdakqdaywahhdlyllayalwptgffr
    lalpdqeemewfeanypgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrv
    sqvpfcpslakgastlrvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelse
    viaelhglrsdgktliaqphvrgdklwtlddikrlncvfknpvkafn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fz1A (A:)
    nraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkde
    rqfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkng
    ylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgd
    avecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvs
    iandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggi
    wigrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeany
    pgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastl
    rvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktli
    aqphvrgdklwtlddikrlncvfknpvkafn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fz1B (B:)
    malstatkaatdalaanraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqf
    kliakeyarmeavkderqfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaa
    tgmlwdsaqaaeqkngylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigpl
    wkgmkrvfsdgfisgdavecslnlqlvgeacftnplivavtewaaangdeitptvflsie
    tdelrhmangyqtvvsiandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvep
    wvktwdrwvyedwggiwigrlgkygvesprslkdakqdaywahhdlyllayalwptgffr
    lalpdqeemewfeanypgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrv
    sqvpfcpslakgastlrvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelse
    viaelhglrsdgktliaqphvrgdklwtlddikrlncvfknpvkafn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fz1B (B:)
    nraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkde
    rqfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkng
    ylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgd
    avecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvs
    iandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggi
    wigrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeany
    pgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastl
    rvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktli
    aqphvrgdklwtlddikrlncvfknpvkafn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fz1C (C:)
    msmlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpna
    dwiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewryt
    drflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvsla
    fwgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfd
    wnesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyy
    nclgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvv
    ddwiedyasridfkadrdqivkavlaglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fz1C (C:)
    smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
    wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
    rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
    wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
    nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
    clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
    dwiedyasridfkadrdqivkavlaglk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fz1D (D:)
    msmlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpna
    dwiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewryt
    drflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvsla
    fwgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfd
    wnesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyy
    nclgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvv
    ddwiedyasridfkadrdqivkavlaglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fz1D (D:)
    smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
    wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
    rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
    wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
    nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
    clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
    dwiedyasridfkadrdqivkavlagl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1fz1E (E:)
    maklgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakl
    eekvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykp
    pimpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fz1E (E:)
    klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
    kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
    mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1fz1F (F:)
    maklgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakl
    eekvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykp
    pimpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fz1F (F:)
    klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
    kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
    mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsph