PDB entry 1fyw

View 1fyw on RCSB PDB site
Description: crystal structure of the tir domain of human tlr2
Class: signaling protein
Keywords: beta-alpha-beta fold parallel beta sheet, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, SIGNALING PROTEIN
Deposited on 2000-10-03, released 2000-11-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.244
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: toll-like receptor 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O60603 (0-148)
    • modified residue (4)
    • modified residue (23)
    • modified residue (37)
    • modified residue (77)
    • modified residue (90)
    • modified residue (114)
    • modified residue (120)
    • modified residue (130)
  Domains in SCOPe 2.06: d1fywa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fywA (A:)
  srnicydafvsyserdaywvenlmvqelenfnppfklclhkrdfipgkwiidniidsiek
  shktvfvlsenfvksewckyeldfshfrlfdenndaailillepiekkaipqrfcklrki
  mntktylewpmdeaqregfwvnlraaiks