PDB entry 1fyv

View 1fyv on RCSB PDB site
Description: crystal structure of the tir domain of human tlr1
Class: signaling protein
Keywords: beta-alpha-beta fold parallel beta sheet, SIGNALING PROTEIN
Deposited on 2000-10-03, released 2000-11-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toll-like receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15399 (0-160)
      • modified residue (39)
      • modified residue (125)
    Domains in SCOPe 2.08: d1fyva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fyvA (A:)
    nipleelqrnlqfhafisysghdsfwvknellpnlekegmqiclhernfvpgksivenii
    tcieksyksifvlspnfvqsewchyelyfahhnlfhegsnslilillepipqysipssyh
    klkslmarrtylewpkekskrglfwanlraainiklteqak