PDB entry 1fys

View 1fys on RCSB PDB site
Description: Ribonuclease T1 V16C mutant
Class: hydrolase
Keywords: ribonuclease, HYDROLASE
Deposited on 2000-10-03, released 2000-10-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanyl-specific ribonuclease t1
    Species: Aspergillus oryzae [TaxId:5062]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00651 (0-103)
      • engineered (15)
      • conflict (24)
    Domains in SCOPe 2.08: d1fysa_
  • Heterogens: CA, 2GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fysA (A:)
    acdytcgsncysssdcstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
    ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect