PDB entry 1fyr

View 1fyr on RCSB PDB site
Description: dimer formation through domain swapping in the crystal structure of the grb2-sh2 ac-pyvnv complex
Class: hormone/growth factor
Keywords: Grb2, SH2 domain, phosphopeptide, Met, domain swapping, dimerization, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2000-10-03, released 2000-12-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fyra_
  • Chain 'B':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fyrb_
  • Chain 'C':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fyrc_
  • Chain 'D':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fyrd_
  • Chain 'I':
    Compound: hepatocyte growth factor receptor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (0-3)
      • modified residue (0)
  • Chain 'J':
    Compound: hepatocyte growth factor receptor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (0-3)
      • modified residue (0)
  • Chain 'K':
    Compound: hepatocyte growth factor receptor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (0-3)
      • modified residue (0)
  • Chain 'L':
    Compound: hepatocyte growth factor receptor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (0-3)
      • modified residue (0)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fyrA (A:)
    gsknyiemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqh
    fkvlrdgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fyrA (A:)
    hpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgagk
    yflwvvkfnslnelvdyhrstsvsrnqqiflrdie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fyrB (B:)
    gsknyiemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqh
    fkvlrdgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fyrB (B:)
    mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
    agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fyrC (C:)
    gsknyiemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqh
    fkvlrdgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fyrC (C:)
    mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
    agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fyrD (D:)
    gsknyiemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqh
    fkvlrdgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fyrD (D:)
    hpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgagk
    yflwvvkfnslnelvdyhrstsvsrnqqiflrdie
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.