PDB entry 1fym

View 1fym on RCSB PDB site
Description: serendipitous crystal structure containing the heat shock transcription factor's DNA binding domain and cognate DNA in a tail-to-tail orientation
Class: transcription/DNA
Keywords: crystal-packing interface, crystallization, protein-DNA interface, protein-protein interface, static disorder, TRANSCRIPTION-DNA COMPLEX
Deposited on 2000-10-02, released 2001-09-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat shock transcription protein
    Species: KLUYVEROMYCES LACTIS [TaxId:28985]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22121 (0-91)
      • engineered (89-91)
    Domains in SCOPe 2.08: d1fyma_
  • Chain 'B':
    Compound: heat shock transcription protein
    Species: KLUYVEROMYCES LACTIS [TaxId:28985]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fymb_
  • Chain 'C':
    Compound: tail-to-tail hse
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: tail-to-tail hse
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1fymA (A:)
arpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrql
nmygwhkvqdvksgsmlsnndsrwefenerha

    Sequence, based on observed residues (ATOM records): (download) 
    >1fymA (A:)
arpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrql
nmygwhkvqdvksndsrwefenerha

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1fymB (B:)
arpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrql
nmygwhkvqdvksgsmlsnndsrwefenerha

    Sequence, based on observed residues (ATOM records): (download) 
    >1fymB (B:)
arpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrql
nmygwhkvqddsrwefen

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.